PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07508g07007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 273aa    MW: 30444.9 Da    PI: 5.2771
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07508g07007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.1e-39152211261
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                               ++k l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  Niben101Scf07508g07007.1 152 PDKFLPCPRCNSMDTKFCYYNNYNVNQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKNS 211
                               78899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-30149209IPR003851Zinc finger, Dof-type
PfamPF027012.6E-32154210IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.919156210IPR003851Zinc finger, Dof-type
PROSITE patternPS013610158194IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MRELKDPEIK LFGKKIALPE NEKVLRLIVS GDVNSGNASY GVTISETIIG SDCDRYLEDE  60
KESSEEKDEG SDEEIQEAEK NHISGDLSET KSEEKDQNQM IEKSEDPKLS LESDNNPKTP  120
NIDEDSPALK TSKTKNDPND ASNSQQKPLK KPDKFLPCPR CNSMDTKFCY YNNYNVNQPR  180
HFCKSCQRYW TAGGTMRNVP VGAGRRKNKN SAPHCRHITM PEALQAERID PPNGFHHPTF  240
KPNGSVLSFG PDSPLCESMA SLMMSSTTAV LSA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505291.11e-156PREDICTED: cyclic dof factor 3-like
TrEMBLA0A0V0HSI61e-122A0A0V0HSI6_SOLCH; Putative cyclic dof factor 3-like (Fragment)
TrEMBLK4BL961e-120K4BL96_SOLLC; Uncharacterized protein
STRINGSolyc03g115940.2.11e-120(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.27e-53cycling DOF factor 2